Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

This Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial spans the amino acid sequence from region 23-117aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ramp3

UniProt

Q9WUP1

Expression Region

23-117aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAND2 Protein Lysate (Mouse) with C-HA Tag
22998034 100 µg

HAND2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
B4GALT6 Recombinant Protein (Mouse)
RP118589 100 µg

B4GALT6 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Sheep Vacuolar fusion protein MON1 homolog A (MON1A) ELISA Kit
OM623483 96 Strip Well

Sheep Vacuolar fusion protein MON1 homolog A (MON1A) ELISA Kit

Sign In for Pricing
View Details
GNRH/LHRH Rabbit Polyclonal Antibody (BF647)
orb2558118 100 µL

GNRH/LHRH Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
BMP7 antibody
70R-12412 100 ug

BMP7 antibody

Sign In for Pricing
View Details
Exosc7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6059805 3x 1.0 µg

Exosc7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details