Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)
This Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active) spans the amino acid sequence from region 56-182aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2 (TRAIL receptor 2; TRAIL-R2) ; CD262; TNFRSF10B; DR5, KILLER, TRAILR2, TRICK2, ZTNFR9; UNQ160/PRO186
UniProt
O14763
Expression Region
56-182aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Immunology & Inflammation; Cell Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/mL can bind Anti-TNFRSF10B recombinant antibody. The EC50 is 1.880-2.195 ng/mL.
Form
Lyophilized powder
Molecular Weight
15.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741147-100 1x 100 µL
CD45RB (PTPRC/1147), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details