Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-3 (Il3)

This Recombinant Mouse Interleukin-3 (Il3) spans the amino acid sequence from region 27-166aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

UniProt

P01586

Expression Region

27-166aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Antibody Discovery - Human LILRB4 / CD85k / ILT3 (22-259) Membrane Protein, PaRoom Temperatureial, -His tag
MP0576F Each

Magic™ Antibody Discovery - Human LILRB4 / CD85k / ILT3 (22-259) Membrane Protein, PaRoom Temperatureial, -His tag

Sign In for Pricing
View Details
NME5 siRNA (Mouse)
orb1839838-01 15 nmol

NME5 siRNA (Mouse)

Sign In for Pricing
View Details
NME5 siRNA (Mouse)
orb1839838-02 30 nmol

NME5 siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit Anti Human MCM3 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)
IRBAHUMCM3AP230120UL 1 Each

Rabbit Anti Human MCM3 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)

Sign In for Pricing
View Details
POU3F4 Protein Vector (Rat) (pPM-C-HA)
37263026 500 ng

POU3F4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PRKAR1B Protein Vector (Mouse) (pPB-C-His)
PV219238 500 ng

PRKAR1B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details