Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta TNF superfamily member 15 (TNFSF15), partial

This Recombinant Macaca mulatta TNF superfamily member 15 (TNFSF15), partial spans the amino acid sequence from region 72-251aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

F6S8F9

Expression Region

72-251aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA9 (NM_005002) Human Recombinant Protein
TP303464L 1 mg

NDUFA9 (NM_005002) Human Recombinant Protein

Sign In for Pricing
View Details
Lithium Hydroxide
TRC-L469115-25G 25 g

Lithium Hydroxide

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Zalcitabine
TRC-Z140000-1G 1 g

Zalcitabine

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), 1 mg/mL
BNUM1920-50 1x 50 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), 1 mg/mL

Sign In for Pricing
View Details