Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial

This Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial spans the amino acid sequence from region 61-284aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASGP-R 1; ASGPR 1; Hepatic lectin 1; HL-1; mHL-1

UniProt

P34927

Expression Region

61-284aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Txn1 Mouse Gene Knockout Kit (CRISPR)
KN318506 1 Kit

Txn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF405S conjugate, 0.1mg/mL
BNC042406-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Lymph node: axillary
CR562638 5 µg

Tissue Total RNA, Lymph node: axillary

Sign In for Pricing
View Details
FITC Conjugated Rabbit Anti-STA Antibody
FAL-4701-2 2 mL

FITC Conjugated Rabbit Anti-STA Antibody

Sign In for Pricing
View Details
PDK2 Recombinant Rabbit Monoclonal Antibody [JB66-93]
ET7107-46 100 µL

PDK2 Recombinant Rabbit Monoclonal Antibody [JB66-93]

Sign In for Pricing
View Details
CWF19L2 Human Gene Knockout Kit (CRISPR)
KN419488 1 Kit

CWF19L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details