Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 20 (Gpr20) -VLPs

This Recombinant Mouse G-protein coupled receptor 20 (Gpr20) -VLPs spans the amino acid sequence from region 1-358aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

UniProt

Q8BYC4

Expression Region

1-358aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MPSALSMRPWDAALPNTTAAAWTNGSVPEMPLFHHFARLDEELQATFPSLWQALMVVHGTIFLAGLVLNGLALYVFCCRTRAKTPSVTYTINLVVTDLLVGLSLPTRFAVFYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVQPEGSRRWRQPACAKAVCIFVWLAAGVVTLSVLGVKSGGRSCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLVIFLVCFTPFHARQVAVALWPNVPKHTSLVAYHVAVTLSSLNSCMDPIVYCFITSGFQATVRGLFYQRGEEFKPSSMDVVSMHKSTKASAPIHILSIGSHTLTQPLTNGPEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNIP4 Human Over-expression Lysate
orb1373537 20 µg

KCNIP4 Human Over-expression Lysate

Sign In for Pricing
View Details
Human hsa-miR-8077 miRNA Antagomir
abx887798-01 10 nmol

Human hsa-miR-8077 miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-8077 miRNA Antagomir
abx887798-02 20 nmol

Human hsa-miR-8077 miRNA Antagomir

Sign In for Pricing
View Details
Mouse Serine/arginine repetitive matrix protein 1 (SRRM1) ELISA kit
GTR10415492 96 Well

Mouse Serine/arginine repetitive matrix protein 1 (SRRM1) ELISA kit

Sign In for Pricing
View Details
ChemR23 shRNA Plasmid (m)
sc-44634-SH 20 µg

ChemR23 shRNA Plasmid (m)

Sign In for Pricing
View Details
NDUFAF2 Polyclonal Antibody
MBS8568988-01 0.1 mL

NDUFAF2 Polyclonal Antibody

Sign In for Pricing
View Details