Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member X2 (Mrgprx2) -VLPs

This Recombinant Mouse Mas-related G-protein coupled receptor member X2 (Mrgprx2) -VLPs spans the amino acid sequence from region 1-352aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member B10

UniProt

Q3UG50

Expression Region

1-352aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MEERNISGRDLRVDSNITYWGTNITAVNESNHTGMSFCEVVSCTMVFLSLIVALVGLVGNATVLWFLGFQMRRNAFSVYILNLAGADFLFICFQIGYCFHMILDIDSIPIEIDLFYLVVLNFPYFCGLSILSAISIERCLSVMWPIWYHCQRPRHTSAVICTLLWVLSLVCSLLEGKECGFLYYTSDPGWCKTFDLITATWLIVLFVALLGSSLALVITIFWGLHKIPVTRLYVAIVFTVLVFLLFGLPYGIYWFLLVWIEKFYYVLPCSIYPVTVFLSCVNSSAKPIIYCLVGSIRHHRFQRKTLKLFLQRAMQDTPEEEECGEMGSSGRSREIKTIWKGLRAALIRHKEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antigen 85-A (M. tb fbpA) Antibody
abx110661-01 20 µg

Antigen 85-A (M. tb fbpA) Antibody

Sign In for Pricing
View Details
Antigen 85-A (M. tb fbpA) Antibody
abx110661-02 50 µg

Antigen 85-A (M. tb fbpA) Antibody

Sign In for Pricing
View Details
Antigen 85-A (M. tb fbpA) Antibody
abx110661-03 100 µg

Antigen 85-A (M. tb fbpA) Antibody

Sign In for Pricing
View Details
Antigen 85-A (M. tb fbpA) Antibody
abx110661-04 200 µg

Antigen 85-A (M. tb fbpA) Antibody

Sign In for Pricing
View Details
Antigen 85-A (M. tb fbpA) Antibody
abx110661-05 1 mg

Antigen 85-A (M. tb fbpA) Antibody

Sign In for Pricing
View Details
PXR Ligand 3
T211869-01 10 mg

PXR Ligand 3

Sign In for Pricing
View Details