Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6E (Ly6e)

This Recombinant Mouse Lymphocyte antigen 6E (Ly6e) spans the amino acid sequence from region 27-108aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6E; Stem cell antigen 2; Thymic shared antigen 1; TSA-1

UniProt

Q64253

Expression Region

27-108aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Omt2a Protein Lysate (Mouse) with C-HA Tag
34817034 100 µg

Omt2a Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Rabbit Monoclonal Cadherin-8 Antibody (032) [DyLight 550]
NBP2-89297R 0.1 mL

Rabbit Monoclonal Cadherin-8 Antibody (032) [DyLight 550]

Sign In for Pricing
View Details
Srg-20 Antibody
orb802495 2 mg

Srg-20 Antibody

Sign In for Pricing
View Details
SPG21 Polyclonal Antibody, APC Conjugated
bs-11785R-APC 100 µL

SPG21 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
SLC23A3 ORF Vector (Human) (pORF)
ORF009605 1.0 µg DNA

SLC23A3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PPHLN Antibody
MBS8587553-01 0.1 mg

PPHLN Antibody

Sign In for Pricing
View Details