Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Programmed cell death 1 ligand 1 (CD274), partial

This Recombinant Human Programmed cell death 1 ligand 1 (CD274), partial spans the amino acid sequence from region 19-238aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PD-L1; PDCD1 ligand 1; Programmed death ligand 1; hPD-L1; B7 homolog 1; B7-H1; CD antigen CD274

UniProt

Q9NZQ7

Expression Region

19-238aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC9 Antibody, Biotin conjugated
A11559-100UG 100 µg

ABCC9 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PDCD4 Antibody
K1E024C16D04C-01 50 ug

PDCD4 Antibody

Sign In for Pricing
View Details
PDCD4 Antibody
K1E024C16D04C-02 100 ug

PDCD4 Antibody

Sign In for Pricing
View Details
PDCD4 Antibody
K1E024C16D04C-03 1 mg

PDCD4 Antibody

Sign In for Pricing
View Details
FAM76A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
20130065 1.0 µg DNA

FAM76A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GER3 Polyclonal Antibody
MBS7150003 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GER3 Polyclonal Antibody

Sign In for Pricing
View Details