Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Japanese encephalitis virus Envelope protein (E), partial

This Recombinant Japanese encephalitis virus Envelope protein (E), partial spans the amino acid sequence from region 301-398aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A1XJE8

Expression Region

301-398aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Japanese encephalitis virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YGMCTEKFSFAKNPADTGHGTVVIELTYSGSDGPCKIPIVSVASLNDMTPVGRLVTVNPFVATSSSNSKVLVEMEPPFGDSYIVVGRGDKQINHHWHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Gly-OH
B-1330.0100 100.0g

Fmoc-Gly-OH

Sign In for Pricing
View Details
Cyp125 Antibody (FITC)
orb352395-01 50 µg

Cyp125 Antibody (FITC)

Sign In for Pricing
View Details
Cyp125 Antibody (FITC)
orb352395-02 100 µg

Cyp125 Antibody (FITC)

Sign In for Pricing
View Details
RB-PEG-SH (MW 600)
T211973-01 10 mg

RB-PEG-SH (MW 600)

Sign In for Pricing
View Details
RB-PEG-SH (MW 600)
T211973-02 50 mg

RB-PEG-SH (MW 600)

Sign In for Pricing
View Details
2-Amino-6-chloro-benzamide
ECA16695-01 0.5 g

2-Amino-6-chloro-benzamide

Sign In for Pricing
View Details