Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin (CALR)

This Recombinant Human Calreticulin (CALR) spans the amino acid sequence from region 18-417aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP; grp60

UniProt

P27797

Expression Region

18-417aa

Tag

N-terminal 10xHis-tagged and C-terminal Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myometrium
CS500161 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
RNF148 Polyclonal Antibody
E-AB-16765-01 20 µL

RNF148 Polyclonal Antibody

Sign In for Pricing
View Details
RNF148 Polyclonal Antibody
E-AB-16765-02 60 µL

RNF148 Polyclonal Antibody

Sign In for Pricing
View Details
RNF148 Polyclonal Antibody
E-AB-16765-03 120 µL

RNF148 Polyclonal Antibody

Sign In for Pricing
View Details
RNF148 Polyclonal Antibody
E-AB-16765-04 200 µL

RNF148 Polyclonal Antibody

Sign In for Pricing
View Details
PTDSS2 Human Gene Knockout Kit (CRISPR)
KN200996LP 1 Kit

PTDSS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details