Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin (CALR)

This Recombinant Human Calreticulin (CALR) spans the amino acid sequence from region 18-417aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP; grp60

UniProt

P27797

Expression Region

18-417aa

Tag

N-terminal 10xHis-tagged and C-terminal Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPCT Antibody
KC-2314-01 50 μL

QPCT Antibody

Sign In for Pricing
View Details
QPCT Antibody
KC-2314-02 100 µL

QPCT Antibody

Sign In for Pricing
View Details
QPCT Antibody
KC-2314-03 1 mL

QPCT Antibody

Sign In for Pricing
View Details
IFluor® 350 succinimidyl ester
71020-AAT 100 µg

IFluor® 350 succinimidyl ester

Sign In for Pricing
View Details
CSE1L Antibody
8C0146-AAT 50 µg

CSE1L Antibody

Sign In for Pricing
View Details
SH3KBP1 Antibody
KC-32858-01 50 μL

SH3KBP1 Antibody

Sign In for Pricing
View Details