Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13)

This Recombinant Mouse Interleukin-13 (Il13) spans the amino acid sequence from region 19-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13; T-cell activation protein P600

UniProt

P20109

Expression Region

19-131aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAG2 Human Gene Knockout Kit (CRISPR)
KN420122 1 Kit

BAG2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMPRSS2 Mouse Monoclonal Antibody [A6D9]
HA600057 100 µL

TMPRSS2 Mouse Monoclonal Antibody [A6D9]

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001291472) Human Tagged ORF Clone
RG235574 10 µg

Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001291472) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human NCF2 activation kit by CRISPRa
GA103118 1 Kit

Human NCF2 activation kit by CRISPRa

Sign In for Pricing
View Details
MCL1 (Ab-159) Antibody
8B1097-AAT 50 µg

MCL1 (Ab-159) Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705553 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details