Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-4 (CLDN4) -Detergent

This Recombinant Human Claudin-4 (CLDN4) -Detergent spans the amino acid sequence from region 1-209aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Clostridium perfringens enterotoxin receptor; CPE-R; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein

UniProt

O14493

Expression Region

1-209aa

Tag

N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH 7.5

AA Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OFD1P18Y Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV772226 1.0 µg DNA

OFD1P18Y Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ZAP70 antibody (Tyr493)
70R-32566 100 ug

ZAP70 antibody (Tyr493)

Sign In for Pricing
View Details
Anti-IGF1R (Dalotuzumab)-SPDB-DM4 ADC
ADC-W-1263 1 mg

Anti-IGF1R (Dalotuzumab)-SPDB-DM4 ADC

Sign In for Pricing
View Details
Human Activin RIA/ALK-2 (NP_001096) VersaClone cDNA
RDC1201 10 µg

Human Activin RIA/ALK-2 (NP_001096) VersaClone cDNA

Sign In for Pricing
View Details
DAT-149-502-10 AB Labels
027349 Pack of 10000 Label(s)

DAT-149-502-10 AB Labels

Sign In for Pricing
View Details
Hus1 CRISPR Activation Plasmid (h)
sc-403287-ACT 20 µg

Hus1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details