Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), partial

This Recombinant Human Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), partial spans the amino acid sequence from region 2-166aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane activator and CAML interactor; CD antigen CD267

UniProt

O14836

Expression Region

2-166aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DM1 Recombinant Mouse Monoclonal Antibody [A4G2-R]
HA601102 100 µL

DM1 Recombinant Mouse Monoclonal Antibody [A4G2-R]

Sign In for Pricing
View Details
Cytochrome P450 2C8 (CYP2C8) (+ 2C9, 2C18, 2C19) Rabbit Polyclonal Antibody
AP06776PU-N 100 µg

Cytochrome P450 2C8 (CYP2C8) (+ 2C9, 2C18, 2C19) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N6-(2-Isopentenyl)adenine
TRC-I874605-500MG 500 mg

N6-(2-Isopentenyl)adenine

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-01 50 μL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-02 100 µL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-03 1 mL

CTAG1A Antibody

Sign In for Pricing
View Details