Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

This Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial spans the amino acid sequence from region 234-362aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-phosphate transport protein 2B; Na (+; NaPi3b; Sodium/phosphate cotransporter 2B; Na (+; NaPi-2b; Solute carrier family 34 member 2

UniProt

O95436

Expression Region

234-362aa

Tag

C-terminal mFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bri3bp activation kit by CRISPRa
GA210622 1 Kit

Mouse Bri3bp activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human MAP1LC3B Protein
E30P64599A 50 µg

Recombinant Human MAP1LC3B Protein

Sign In for Pricing
View Details
SPDMV
orb1987724-01 1 mg

SPDMV

Sign In for Pricing
View Details
SPDMV
orb1987724-02 5 mg

SPDMV

Sign In for Pricing
View Details
Recombinant Clostridium Thermocellum speE Protein (aa 1-275)
VAng-Lsx02106-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Thermocellum speE Protein (aa 1-275)

Sign In for Pricing
View Details
Protocadherin Gamma A3 (Pcdhga3) Antibody (ATTO 594)
abx441054 100 µg

Protocadherin Gamma A3 (Pcdhga3) Antibody (ATTO 594)

Sign In for Pricing
View Details