Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Erythropoietin (EPO)

This Recombinant Macaca mulatta Erythropoietin (EPO) spans the amino acid sequence from region 28-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q28513

Expression Region

28-192aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPRLVCDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRIEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GRK5 ELISA Kit
E053587 1 Each

Mouse GRK5 ELISA Kit

Sign In for Pricing
View Details
Ric1 (NM_001081319) Mouse Untagged Clone
MC224438 10 µg

Ric1 (NM_001081319) Mouse Untagged Clone

Sign In for Pricing
View Details
C5orf41 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0241106 1.0 µg DNA

C5orf41 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Hsa-miR-548d-3p miRNA Inhibitor
CIH0429-01 10 nmol

Hsa-miR-548d-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-548d-3p miRNA Inhibitor
CIH0429-02 20 nmol

Hsa-miR-548d-3p miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit A (nuoA)
MBS7023798-01 0.02 mg

Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details