Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma (IFNG) (Active)

This Recombinant Human Interferon gamma (IFNG) (Active) spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma; IFN-gamma; Immune interferon; IFNG

UniProt

P01579

Expression Region

24-166aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA.Immobilized Human IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody. The EC50 is 74.23-96.56 ng/mL. 2Measured by its ability to inhibit proliferation of HT-29 cells. The ED50 for this effect is 0.2120-0.2940 ng/mL.

Form

Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin, Alpha-Smooth Muscle; Clone 1A4 (Ready-To-Use)
A00002-0025 25 mL

Actin, Alpha-Smooth Muscle; Clone 1A4 (Ready-To-Use)

Sign In for Pricing
View Details
Potato Dextrose Agar Slant
SL096-10SL 1 unit

Potato Dextrose Agar Slant

Sign In for Pricing
View Details
PRKACG
MBS6007891-01 0.1 mL

PRKACG

Sign In for Pricing
View Details
PRKACG
MBS6007891-02 5x 0.1 mL

PRKACG

Sign In for Pricing
View Details
Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody [Clone ID: OTI4G4]
CF802454 100 µg

Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody [Clone ID: OTI4G4]

Sign In for Pricing
View Details
Nornicotine-2-carboxylic Acid
sc-212415 5 mg

Nornicotine-2-carboxylic Acid

Sign In for Pricing
View Details