Recombinant Human Teratocarcinoma-derived growth factor 1 (TDGF1)
This Recombinant Human Teratocarcinoma-derived growth factor 1 (TDGF1) spans the amino acid sequence from region 31-150aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cripto-1 growth factor; CRGF; Epidermal growth factor-like cripto protein CR1
UniProt
P13385
Expression Region
31-150aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
42.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Ly3072-inquire Inquire
Recombinant Caenorhabditis Elegans best-5 Protein (aa 1-453)
Sign In for Pricing
View Details NSL0002Sp 96 Tests
Sheep contagious pleuropneumonia (SCP) ELISA Kit
Sign In for Pricing
View Details ![7-Cyclopropylpyrazolo[1,5-a]pyrimidine-3-carbonitrile](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
sc-319707 1 mg
7-Cyclopropylpyrazolo[1,5-a]pyrimidine-3-carbonitrile
Sign In for Pricing
View Details