Recombinant Mouse C-C motif chemokine 17 (Ccl17) (Active)
This Recombinant Mouse C-C motif chemokine 17 (Ccl17) (Active) spans the amino acid sequence from region 24-93aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
C-C motif chemokine 17; ABCD-2; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; Ccl17; Tarc
UniProt
Q9WUZ6
Expression Region
24-93aa
Tag
C-terminal mFc-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody at 2 μg/mL can bind Mouse Ccl17 protein. The EC50 is 0.9792-1.486 ng/mL.
Form
Lyophilized powder
Molecular Weight
37.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402217-100 1x 100 µL
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042316-100 1x 100 µL
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details