Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial (Active)

This Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial (Active) spans the amino acid sequence from region 33-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1

UniProt

P09603

Expression Region

33-190aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 2.880-4.115 ng/mL.

Form

Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2-Bromo-4-methylphenyl) cyclohexan-1-amine hydrochloride
JBD30898-01 50 mg

1- (2-Bromo-4-methylphenyl) cyclohexan-1-amine hydrochloride

Sign In for Pricing
View Details
1- (2-Bromo-4-methylphenyl) cyclohexan-1-amine hydrochloride
JBD30898-02 0.5 g

1- (2-Bromo-4-methylphenyl) cyclohexan-1-amine hydrochloride

Sign In for Pricing
View Details
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
RP00479-01 100 μg

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Sign In for Pricing
View Details
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
RP00479-02 500 μg

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Sign In for Pricing
View Details
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
RP00479-03 1000 μg

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Sign In for Pricing
View Details
UCP3 CRISPR/Cas9 KO Plasmid (m2)
sc-423597-KO-2 20 µg

UCP3 CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details