Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I chain-related molecule B (MICB), partial (Active)

This Recombinant Human MHC class I chain-related molecule B (MICB), partial (Active) spans the amino acid sequence from region 204-297aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

O16470

Expression Region

204-297aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human MICB at 2 μg/mL can bind Anti-MICA/B recombinant antibody. The EC50 is 26.77-32.93 ng/mL.

Form

Lyophilized powder

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

TVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dusp11 Pre-designed siRNA Set A
SI204101A 1 Each

Rat Dusp11 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Ribosomal Protein L18 Rabbit Polyclonal Antibody
APRab17150-01 20 µL

Ribosomal Protein L18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L18 Rabbit Polyclonal Antibody
APRab17150-02 50 µL

Ribosomal Protein L18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L18 Rabbit Polyclonal Antibody
APRab17150-03 100 µL

Ribosomal Protein L18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L18 Rabbit Polyclonal Antibody
APRab17150-04 200 µL

Ribosomal Protein L18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PEX14 Rabbit Polyclonal Antibody (FITC)
orb2093199 100 µL

PEX14 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details