Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial

This Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial spans the amino acid sequence from region 31-297aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

31-297aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMSFWKEDTMKTNTHYRAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDRNGTYYTWVATRIRQGEEQKFACYMEHSGNHSTHPVPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pinacolone-d9
TRC-P457802-1MG 1 mg

Pinacolone-d9

Sign In for Pricing
View Details
PRDX3 Antibody
CSB-PA210969-01 50 μL

PRDX3 Antibody

Sign In for Pricing
View Details
PRDX3 Antibody
CSB-PA210969-02 100 µL

PRDX3 Antibody

Sign In for Pricing
View Details
BHMT Antibody
E311098 200 µL

BHMT Antibody

Sign In for Pricing
View Details
PTPN1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-55182R-PE-Cy7 100 µL

PTPN1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Goat anti-TUBA4A Polyclonal antibody
AB0134-200 600 µg

Goat anti-TUBA4A Polyclonal antibody

Sign In for Pricing
View Details