Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial

This Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial spans the amino acid sequence from region 31-297aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

31-297aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMSFWKEDTMKTNTHYRAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDRNGTYYTWVATRIRQGEEQKFACYMEHSGNHSTHPVPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 2-chloro-4- (difluoromethoxy) benzoate
PC1022510-01 250 mg

Methyl 2-chloro-4- (difluoromethoxy) benzoate

Sign In for Pricing
View Details
Methyl 2-chloro-4- (difluoromethoxy) benzoate
PC1022510-02 500 mg

Methyl 2-chloro-4- (difluoromethoxy) benzoate

Sign In for Pricing
View Details
Methyl 2-chloro-4- (difluoromethoxy) benzoate
PC1022510-03 1 g

Methyl 2-chloro-4- (difluoromethoxy) benzoate

Sign In for Pricing
View Details
Methyl 2-chloro-4- (difluoromethoxy) benzoate
PC1022510-04 5 g

Methyl 2-chloro-4- (difluoromethoxy) benzoate

Sign In for Pricing
View Details
GNAQ Rabbit pAb
E2514736 100 µL

GNAQ Rabbit pAb

Sign In for Pricing
View Details
HK3 (Hexokinase III) (CT) Antibody
3143-100 100 µg

HK3 (Hexokinase III) (CT) Antibody

Sign In for Pricing
View Details