Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cucumis sativus Citrate transporter-like domain-containing protein, partial-VLPs

This Recombinant Cucumis sativus Citrate transporter-like domain-containing protein, partial-VLPs spans the amino acid sequence from region 1-251aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

UniProt

A0A0A0L6L7

Expression Region

1-251aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Cucumis sativus (Cucumber)

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MAMDHTVKVILGSIAFAVFWLLAVFPAIPFLPIGRTAGSILGAMLMVVFRVLTPEQAYAAIDLPILGLLFGTMVVSVYLERADMFKYLGKVLSWKSKGAKDLICRVCLISAISSAFFTNDTSCVVLTEFVLKIARQHNLPPRPFLLALASSANIGSSATPIGNPQNLVIAVQSKIHFGQFVIGILPAMLVGVVVNALIILIMYWKLLSVQKDEEDPSPEVIADEDVLSHRFSPARLSHSQIPSLNSAEWDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), CF640R conjugate, 0.1mg/mL
BNC400303-500 1x 500 µL

Neurofilament (NF-L) (NR-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PD7/26), CF640R conjugate, 0.1mg/mL
BNC400472-500 1x 500 µL

CD45RB (PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details