Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC Class I chain-related protein (MICA), partial (Active)

This Recombinant Human MHC Class I chain-related protein (MICA), partial (Active) spans the amino acid sequence from region 24-309aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC Class I chain-related protein; MHC class I polypeptide-related sequence A; MICA

UniProt

J9TPG6

Expression Region

24-309aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human MICA at 2 μg/mL can bind Anti-MICA/B recombinant antibody. The EC50 is 0.6924-0.9195 ng/mL.

Form

Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

EPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octadecanedioic Acid
TRC-O235303-5G 5 g

Octadecanedioic Acid

Sign In for Pricing
View Details
Pericentrin (PCNT) Human Gene Knockout Kit (CRISPR)
KN415393 1 Kit

Pericentrin (PCNT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac 3,4-Dihydroxyphenylethylene Glycol
TRC-D454510-25MG 25 mg

rac 3,4-Dihydroxyphenylethylene Glycol

Sign In for Pricing
View Details
Equilin
TRC-E592800-25MG 25 mg

Equilin

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NUSAP1 Antibody
8C17144-AAT 50 µg

NUSAP1 Antibody

Sign In for Pricing
View Details