Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tissue factor (F3), partial

This Recombinant Mouse Tissue factor (F3), partial spans the amino acid sequence from region 29-251aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TF; Coagulation factor III; CD antigen CD142

UniProt

P20352

Expression Region

29-251aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IGFLR1/TMEM149 Antibody (905338) [Janelia Fluor 525]
FAB8296JF525 0.1 mL

Mouse Monoclonal IGFLR1/TMEM149 Antibody (905338) [Janelia Fluor 525]

Sign In for Pricing
View Details
Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit
YLA0110RB-01 48 Tests

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit

Sign In for Pricing
View Details
Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit
YLA0110RB-02 96 Tests

Rabbit 8-Hydroxy-desoxyguanosine,8-OHdG ELISA Kit

Sign In for Pricing
View Details
6-Chloro-3-phenyl-1-benzofuran-2-carboxylic acid
OR1072996-01 1 g

6-Chloro-3-phenyl-1-benzofuran-2-carboxylic acid

Sign In for Pricing
View Details
6-Chloro-3-phenyl-1-benzofuran-2-carboxylic acid
OR1072996-02 5 g

6-Chloro-3-phenyl-1-benzofuran-2-carboxylic acid

Sign In for Pricing
View Details
Eukaryotic Interleukin 29 (IL29)
SFPC292Ra61-01 10 µg

Eukaryotic Interleukin 29 (IL29)

Sign In for Pricing
View Details