Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (Active)
This Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) spans the amino acid sequence from region 29-159aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Thymic stromal lymphopoietin; TSLP
UniProt
A0A7N9CAT7
Expression Region
29-159aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Immunology & Inflammation
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TSLP at 2 μg/mL can bind Anti-TSLP recombinant antibody. The EC50 is 47.21-52.37 ng/mL.
Form
Lyophilized powder
Molecular Weight
16.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470158-500 1x 500 µL
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details