Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Programmed Cell Death Protein 1 precursor, partial, Biotinylated

This Recombinant Dog Programmed Cell Death Protein 1 precursor, partial, Biotinylated spans the amino acid sequence from region 25-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Expression Region

25-168aa

Tag

C-terminal hFc1-Avi-tagged

Source

Mammalian cell

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVTRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM195 (AGMO) Rabbit Polyclonal Antibody
TA335316 100 µL

TMEM195 (AGMO) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ras (mutated Q61R) Antibody [E15B9]
C15391-100uL 100 µL

Ras (mutated Q61R) Antibody [E15B9]

Sign In for Pricing
View Details
Rabbit Polyclonal DARS2 Antibody [mFluor Violet 500 SE]
NBP2-97255MFV500 0.1 mL

Rabbit Polyclonal DARS2 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
NOL10 Polyclonal Antibody
MBS2574597-01 0.06 mL

NOL10 Polyclonal Antibody

Sign In for Pricing
View Details
NOL10 Polyclonal Antibody
MBS2574597-02 0.12 mL

NOL10 Polyclonal Antibody

Sign In for Pricing
View Details
NOL10 Polyclonal Antibody
MBS2574597-03 0.2 mL

NOL10 Polyclonal Antibody

Sign In for Pricing
View Details