Recombinant Mouse Kit ligand (Kitlg), partial (Active)

Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor (MGF) ; Steel factor; Stem cell factor (SCF) ; c-Kit ligand; Soluble KIT ligand (sKITLG) ; KitlgKitl, Mgf, Sl, Slf

1The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 1.691-11.94 ng/mL. 2Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/ml can bind Mouse Kit. The EC50 is 15.57-20.95 ng/mL.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA