Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kit ligand (Kitlg), partial (Active)

This Recombinant Mouse Kit ligand (Kitlg), partial (Active) spans the amino acid sequence from region 26-189aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor (MGF) ; Steel factor; Stem cell factor (SCF) ; c-Kit ligand; Soluble KIT ligand (sKITLG) ; KitlgKitl, Mgf, Sl, Slf

UniProt

P20826

Expression Region

26-189aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 1.691-11.94 ng/mL. 2Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/ml can bind Mouse Kit. The EC50 is 15.57-20.95 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF148 Blocking Peptide
CBP4320-01 1 mg

ZNF148 Blocking Peptide

Sign In for Pricing
View Details
ZNF148 Blocking Peptide
CBP4320-02 5 mg

ZNF148 Blocking Peptide

Sign In for Pricing
View Details
Sheep Nucleoporin 155kDa ELISA Kit
MBS748848-01 48 Well

Sheep Nucleoporin 155kDa ELISA Kit

Sign In for Pricing
View Details
Sheep Nucleoporin 155kDa ELISA Kit
MBS748848-02 96 Well

Sheep Nucleoporin 155kDa ELISA Kit

Sign In for Pricing
View Details
Sheep Nucleoporin 155kDa ELISA Kit
MBS748848-03 5x 96 Well

Sheep Nucleoporin 155kDa ELISA Kit

Sign In for Pricing
View Details
Sheep Nucleoporin 155kDa ELISA Kit
MBS748848-04 10x 96 Well

Sheep Nucleoporin 155kDa ELISA Kit

Sign In for Pricing
View Details