Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 beta (IL1B) (Active)

This Recombinant Human Interleukin-1 beta (IL1B) spans the amino acid sequence from region 117-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-1 beta; IL-1 beta; Catabolin; IL1B; IL1F2

UniProt

P01584

Expression Region

117-269aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human IL1B at 5 μg/mL can bind Human IL1R2. The EC50 is 89.65-100.5 ng/mL.

Form

Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W/W007/NT/RFL-TRI310-1 Safety & Regulatory Compliance Signs & Labels (Adhesive)
304356 1 Pack (1 Panel (s) x 1 Pack)

W/W007/NT/RFL-TRI310-1 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Recombinant Simian Carbonic Anhydrase II (CA2)
RPU40601-01 50 µg

Recombinant Simian Carbonic Anhydrase II (CA2)

Sign In for Pricing
View Details
Recombinant Simian Carbonic Anhydrase II (CA2)
RPU40601-02 100 µg

Recombinant Simian Carbonic Anhydrase II (CA2)

Sign In for Pricing
View Details
Recombinant Simian Carbonic Anhydrase II (CA2)
RPU40601-03 1 mg

Recombinant Simian Carbonic Anhydrase II (CA2)

Sign In for Pricing
View Details
Bovine TRAPPC9 ELISA KIT
ELI-51135b 96 Tests

Bovine TRAPPC9 ELISA KIT

Sign In for Pricing
View Details
ELISA Kit For 4F2 cell-surface antigen heavy chain
E2005m 96 Tests

ELISA Kit For 4F2 cell-surface antigen heavy chain

Sign In for Pricing
View Details