Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiopoietin-1 (Angpt1), partial

This Recombinant Mouse Angiopoietin-1 (Angpt1), partial spans the amino acid sequence from region 277-498aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ANG-1

UniProt

O08538

Expression Region

277-498aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

REEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPC5 Antibody
8C15478-AAT 50 µg

RPC5 Antibody

Sign In for Pricing
View Details
Tatdn1 Mouse Gene Knockout Kit (CRISPR)
KN517226 1 Kit

Tatdn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
Human DOPA Decarboxylase (DDC) activation kit by CRISPRa
GA101159 1 Kit

Human DOPA Decarboxylase (DDC) activation kit by CRISPRa

Sign In for Pricing
View Details