Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor 2 (IGF2)

This Recombinant Human Growth/differentiation factor 9 (GDF9) spans the amino acid sequence from region 25-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-II; Erythrotropin

UniProt

P07456

Expression Region

25-91aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSB (359-372) Goat Polyclonal Antibody
AP08576PU-N 50 µg

ARSB (359-372) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Prostate
CR562213 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
Annexin V-iFluor® 488 conjugate
20071-AAT 100 Tests

Annexin V-iFluor® 488 conjugate

Sign In for Pricing
View Details
Pts Mouse Gene Knockout Kit (CRISPR)
KN514248 1 Kit

Pts Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), 0.2mg/mL
BNUB2540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant SFRP1 Antibody
RC-15577-01 50 μL

Recombinant SFRP1 Antibody

Sign In for Pricing
View Details