Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor 2 (IGF2)

This Recombinant Human Growth/differentiation factor 9 (GDF9) spans the amino acid sequence from region 25-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-II; Erythrotropin

UniProt

P07456

Expression Region

25-91aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pfdn1 (NM_026027) Mouse Tagged ORF Clone
MG200613 10 µg

Pfdn1 (NM_026027) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SERPING1 (NM_000062) Human Recombinant Protein
TP720444L 500 µg

SERPING1 (NM_000062) Human Recombinant Protein

Sign In for Pricing
View Details
TMPRSS13 Rabbit Polyclonal Antibody
TA365083 100 µL

TMPRSS13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX10 (SOX10/991), CF594 conjugate, 0.1mg/mL
BNC940991-100 1x 100 µL

SOX10 (SOX10/991), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Recombinant Protein
TP311377M 100 µg

Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Recombinant Protein

Sign In for Pricing
View Details
TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3106), CF405S conjugate, 0.1mg/mL
BNC043106-500 1x 500 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details