Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor 2 (IGF2)

This Recombinant Human Growth/differentiation factor 9 (GDF9) spans the amino acid sequence from region 25-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-II; Erythrotropin

UniProt

P07456

Expression Region

25-91aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM1 (NM_002629) Human Over-expression Lysate
LY400934 100 µg

PGAM1 (NM_002629) Human Over-expression Lysate

Sign In for Pricing
View Details
SUPT20HL1 Human Gene Knockout Kit (CRISPR)
KN427073 1 Kit

SUPT20HL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNG2 Antibody
8C17810-AAT 50 µg

KCNG2 Antibody

Sign In for Pricing
View Details
Recombinant HNRNPA1L2 Antibody
RC-5222-01 50 μL

Recombinant HNRNPA1L2 Antibody

Sign In for Pricing
View Details
Recombinant HNRNPA1L2 Antibody
RC-5222-02 100 µL

Recombinant HNRNPA1L2 Antibody

Sign In for Pricing
View Details
Recombinant HNRNPA1L2 Antibody
RC-5222-03 1 mL

Recombinant HNRNPA1L2 Antibody

Sign In for Pricing
View Details