Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active)
This Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active) spans the amino acid sequence from region 30-403aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Inactive tyrosine-protein kinase transmembrane receptor ROR1; mROR1; Neurotrophic tyrosine kinase, receptor-related 1; Ror1; Ntrkr1
UniProt
Q9Z139
Expression Region
30-403aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Stem Cell & Developmental Biology; Pharmacology & Drug Discovery
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Ror1 at 2 μg/mL can bind Anti-ROR1 recombinant antibody. The EC50 is 0.8551-0.9363 ng/mL.
Form
Lyophilized powder
Molecular Weight
44.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Galectin 3 (LGALS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI21C1]](https://cdn.genprice.uk/products/937/68dd1b7b061270361ea1c3d9/imageurl/ta804700bm.webp)
TA804700BM 100 µL
Galectin 3 (LGALS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI21C1]
Sign In for Pricing
View Details 
BNC040470-500 1x 500 µL
CD45 / LCA (2B11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1670-100 1x 100 µL
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2215-500 1x 500 µL
Tyrosinase (Melanoma Marker) (rOCA1/812), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![NDUFA4L2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F4]](https://cdn.genprice.uk/products/937/68dd1b84061270361ea1fafd/imageurl/ta810671am.webp)
TA810671AM 100 µL
NDUFA4L2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F4]
Sign In for Pricing
View Details