Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1)

This Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1) spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I

UniProt

Q13541

Expression Region

1-118aa

Tag

N-terminal mFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBBP8 siRNA (Rat)
MBS8210972-01 15 nmol

RBBP8 siRNA (Rat)

Sign In for Pricing
View Details
RBBP8 siRNA (Rat)
MBS8210972-02 30 nmol

RBBP8 siRNA (Rat)

Sign In for Pricing
View Details
RBBP8 siRNA (Rat)
MBS8210972-03 5x 30 nmol

RBBP8 siRNA (Rat)

Sign In for Pricing
View Details
Cytochrome P450 2C8 (CYP2C8) Human Gene Knockout Kit (CRISPR)
KN404605 1 Kit

Cytochrome P450 2C8 (CYP2C8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GTF2E2 Polyclonal Antibody
31631-01 50 µL

GTF2E2 Polyclonal Antibody

Sign In for Pricing
View Details
GTF2E2 Polyclonal Antibody
31631-02 100 µL

GTF2E2 Polyclonal Antibody

Sign In for Pricing
View Details