Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1)
This Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1) spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I
UniProt
Q13541
Expression Region
1-118aa
Tag
N-terminal mFc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
12.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1625-carrier-free 100 µg/Vial
Anti-Kallikrein 1/KLK1 Antibody Picoband®, Carrier-free
Sign In for Pricing
View Details 
MBS2578504-01 25 Tests
SARS-CoV-2 Spike IgG Antibody Test Kit (Enzyme-linked immunosorbent assay)
Sign In for Pricing
View Details MBS2578504-02 5x 25 Tests
SARS-CoV-2 Spike IgG Antibody Test Kit (Enzyme-linked immunosorbent assay)
Sign In for Pricing
View Details