Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte activation gene 3 protein (Lag3), partial, Biotinylated

This Recombinant Mouse Lymphocyte activation gene 3 protein (Lag3), partial, Biotinylated spans the amino acid sequence from region 24-422aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAG-3; Activation-induced cytidine deaminase-linked autoimmunity protein; Aida; CD antigen CD223; sLAG-3

UniProt

Q61790

Expression Region

24-422aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCHLPPGVGTPSLLIAKWTPPGGGPELPVAGKSGNFTLHLEAVGLAQAGTYTCSIHLQGQQLNATVTLAVITVTPKSFGLPGSRGKLLCEVTPASGKERFVWRPLNNLSRSCPGPVLEIQEARLLAERWQCQLYEGQRLLGATVYAAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRH1 (NM_001291315) Human Tagged ORF Clone
RC236519 10 µg

PRH1 (NM_001291315) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Beta-Endorphin (bEP) ELISA Kit
abx355201 96 Well

Rabbit Beta-Endorphin (bEP) ELISA Kit

Sign In for Pricing
View Details
Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS4501668-01 48 Tests

Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS4501668-02 96 Tests

Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS4501668-03 5x 96 Tests

Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS4501668-04 10x 96 Tests

Mouse Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details