Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin superfamily member 11 (IGF1R), partial

This Recombinant Human Immunoglobulin superfamily member 11 (IGF1R), partial spans the amino acid sequence from region 23-241aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IgSF11; Brain and testis-specific immunoglobulin superfamily protein; Bt-IGSF; V-set and immunoglobulin domain-containing protein 3

UniProt

Q5DX21

Expression Region

23-241aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Aoah shRNA (UAS) - Lentiviral mouse Aoah shRNA (UAS, iRFP) (25)
GTR15181502 1 Vial

Lentiviral mouse Aoah shRNA (UAS) - Lentiviral mouse Aoah shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
NLK (Nemo-like Kinase, DKFZp761G1211, FLJ21033) (APC)
MBS6166318-01 0.1 mL

NLK (Nemo-like Kinase, DKFZp761G1211, FLJ21033) (APC)

Sign In for Pricing
View Details
NLK (Nemo-like Kinase, DKFZp761G1211, FLJ21033) (APC)
MBS6166318-02 5x 0.1 mL

NLK (Nemo-like Kinase, DKFZp761G1211, FLJ21033) (APC)

Sign In for Pricing
View Details
Cyclophilin B Antibody (2B10) , AbFluor 488 Conjugated
N1079-01 50 µL

Cyclophilin B Antibody (2B10) , AbFluor 488 Conjugated

Sign In for Pricing
View Details
Cyclophilin B Antibody (2B10) , AbFluor 488 Conjugated
N1079-02 100 µL

Cyclophilin B Antibody (2B10) , AbFluor 488 Conjugated

Sign In for Pricing
View Details
Cyclophilin B Antibody (2B10) , AbFluor 488 Conjugated
N1079-03 500 µL

Cyclophilin B Antibody (2B10) , AbFluor 488 Conjugated

Sign In for Pricing
View Details