Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial

This Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial spans the amino acid sequence from region 36-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Atrial natriuretic peptide receptor 3; Atrial natriuretic peptide clearance receptor; Atrial natriuretic peptide receptor type C (ANP-C; ANPR-C; NPR-C)

UniProt

P17342

Expression Region

36-127aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD67 (GAD1) Rabbit Polyclonal Antibody
AP06389PU-N 100 µg

GAD67 (GAD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TJP1 Human Gene Knockout Kit (CRISPR)
KN216224LP 1 Kit

TJP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ReadiCleave™ XFD532 SSL-NHS ester
7051-AAT 1 mg

ReadiCleave™ XFD532 SSL-NHS ester

Sign In for Pricing
View Details
S100A1 (Melanoma Marker) (S100A1/1942), CF405S conjugate, 0.1mg/mL
BNC041942-100 1x 100 µL

S100A1 (Melanoma Marker) (S100A1/1942), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pyflubumide
TRC-P841780-5MG 5 mg

Pyflubumide

Sign In for Pricing
View Details
KLF6 Rabbit Polyclonal Antibody
TA373071 100 µL

KLF6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details