Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB)

This Recombinant Bacteriophage H30 Shiga-like toxin 1 subunit B (stxB) spans the amino acid sequence from region 21-89aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLT-1 B subunit; SLT-1b; SLT-Ib; Verocytotoxin 1 subunit B; Verotoxin 1 subunit B

UniProt

P69178

Expression Region

21-89aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Bacteriophage H30

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lipase A, Lysosomal Acid (LIPA) ELISA Kit
orb1947036-01 48 Tests

Mouse Lipase A, Lysosomal Acid (LIPA) ELISA Kit

Sign In for Pricing
View Details
Mouse Lipase A, Lysosomal Acid (LIPA) ELISA Kit
orb1947036-02 96 Tests

Mouse Lipase A, Lysosomal Acid (LIPA) ELISA Kit

Sign In for Pricing
View Details
KCNB1 Antibody, HRP conjugated
A54197-100UL 100 µL

KCNB1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human Growth Regulated Protein-beta/CXCL2
P1447-.1 100 µg

Recombinant Human Growth Regulated Protein-beta/CXCL2

Sign In for Pricing
View Details
TMEM105 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46858061 1.0 µg DNA

TMEM105 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2-[[ (4-Cyanophenyl) amino]methyl]-1-methyl-1H-benzimidazole-5-carboxylic-d3 Acid Ethyl Ester
007209 500 µg

2-[[ (4-Cyanophenyl) amino]methyl]-1-methyl-1H-benzimidazole-5-carboxylic-d3 Acid Ethyl Ester

Sign In for Pricing
View Details