Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin regulatory light chain 12A (MYL12A)

This Recombinant Human Myosin regulatory light chain 12A (MYL12A) spans the amino acid sequence from region 1-171aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymis secretory protein Li 24; HEL-S-24; MLC-2B; Myosin RLC; Myosin regulatory light chain 2, nonsarcomeric; Myosin regulatory light chain MRLC3

UniProt

P19105

Expression Region

1-171aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD13P2 Protein Vector (Human) (pPM-C-HA)
44825021 500 ng

SNORD13P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Protein A Standard H for F740 Kit
F743H 1 mL

Protein A Standard H for F740 Kit

Sign In for Pricing
View Details
Rat Atherin (SAMD1) ELISA kit
GTR10433532 96 Well

Rat Atherin (SAMD1) ELISA kit

Sign In for Pricing
View Details
CCL16 Antibody
MBS7128680-01 0.05 mL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
MBS7128680-02 0.1 mL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
MBS7128680-03 5x 0.1 mL

CCL16 Antibody

Sign In for Pricing
View Details