Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombopoietin (THPO)

This Recombinant Human Thrombopoietin (THPO) spans the amino acid sequence from region 22-353aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-mpl ligand; ML; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; MGDF; Myeloproliferative leukemia virus oncogene ligand

UniProt

P40225

Expression Region

22-353aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-8-aoc-oh
MBS5814377 Inquire

Boc-8-aoc-oh

Sign In for Pricing
View Details
Anti-ICAM-1 (15.2) In Vivo Antibody - Low Endotoxin
ICH1027-100mg 100 mg

Anti-ICAM-1 (15.2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG H&L Antibody (HRP)
abx242871 300 µL

Goat Anti-Rabbit IgG H&L Antibody (HRP)

Sign In for Pricing
View Details
HLA-DRB4 AAV siRNA Pooled Vector
23443161 1.0 µg

HLA-DRB4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
RPL13A antibody - middle region (ARP58522_P050)
ARP58522_P050 100 µL

RPL13A antibody - middle region (ARP58522_P050)

Sign In for Pricing
View Details
1-Phenylethane-1,2-diamine
FAA70056-01 100 mg

1-Phenylethane-1,2-diamine

Sign In for Pricing
View Details