Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interleukin-13 (IL13)

This Recombinant Dog Interleukin-13 (IL13) spans the amino acid sequence from region 19-131aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13

UniProt

Q9N0W9

Expression Region

19-131aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATP5H Antibody [DyLight 488]
NBP2-97512G 0.1 mL

Rabbit Polyclonal ATP5H Antibody [DyLight 488]

Sign In for Pricing
View Details
Rabbit Polyclonal IRAK4 Antibody [Alexa Fluor 700]
NBP1-77231AF700 0.1 mL

Rabbit Polyclonal IRAK4 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Rabbit Polyclonal RNF121 Antibody [DyLight 488]
NBP2-81947G 0.1 mL

Rabbit Polyclonal RNF121 Antibody [DyLight 488]

Sign In for Pricing
View Details
Goat anti-ARL4A Antibody
dAP-0099 50 µg

Goat anti-ARL4A Antibody

Sign In for Pricing
View Details
Anti-Caspr2/CNTNAP2 Antibody Picoband®, Carrier-free
A02819-2-carrier-free 100 µg/Vial

Anti-Caspr2/CNTNAP2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g56450 Polyclonal Antibody
MBS9008261 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g56450 Polyclonal Antibody

Sign In for Pricing
View Details