Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Serine/threonine-protein kinase receptor (ACVRL1), partial (Active)

This Recombinant Macaca fascicularis Serine/threonine-protein kinase receptor (ACVRL1), partial (Active) spans the amino acid sequence from region 22-118aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine/threonine-protein kinase receptor; EC:2.7.11.30; ACVRL1

UniProt

A0A2K5WXU2

Expression Region

22-118aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody. The EC50 is 6.893-8.194 ng/mL.

Form

Lyophilized powder

Molecular Weight

11.59 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

DPVKPSRGPLVTCTCESPHCRGPTCQGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF640R conjugate, 0.1mg/mL
BNC401856-100 1x 100 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL
BNC881788-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details