Recombinant Macaca fascicularis Serine/threonine-protein kinase receptor (ACVRL1), partial (Active)
This Recombinant Macaca fascicularis Serine/threonine-protein kinase receptor (ACVRL1), partial (Active) spans the amino acid sequence from region 22-118aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Serine/threonine-protein kinase receptor; EC:2.7.11.30; ACVRL1
UniProt
A0A2K5WXU2
Expression Region
22-118aa
Tag
C-terminal 6xHis-tagged
Source
Baculovirus
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Pharmacology & Drug Discovery
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody. The EC50 is 6.893-8.194 ng/mL.
Form
Lyophilized powder
Molecular Weight
11.59 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
DPVKPSRGPLVTCTCESPHCRGPTCQGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401856-100 1x 100 µL
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881788-100 1x 100 µL
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details