Recombinant Human TGF-beta receptor type-2 (TGFBR2), partial
This Recombinant Human TGF-beta receptor type-2 (TGFBR2), partial spans the amino acid sequence from region 23-159aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
TGFR-2; TGF-beta type II receptor; Transforming growth factor-beta receptor type II (TGF-beta receptor type II; TbetaR-II)
UniProt
P37173
Expression Region
23-159aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation; Cell Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8121281-01 0.05 mg
OX40L/TNFSF4 Protein, Human, Recombinant (ECD, hFc Tag)
Sign In for Pricing
View Details MBS8121281-02 0.5 mg
OX40L/TNFSF4 Protein, Human, Recombinant (ECD, hFc Tag)
Sign In for Pricing
View Details MBS8121281-03 5x 0.5 mg
OX40L/TNFSF4 Protein, Human, Recombinant (ECD, hFc Tag)
Sign In for Pricing
View Details