Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parabacteroides distasonis Outer membrane protein beta-barrel domain-containing protein

This Recombinant Parabacteroides distasonis Outer membrane protein beta-barrel domain-containing protein spans the amino acid sequence from region 15-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A174MNQ6

Expression Region

15-155aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Parabacteroides distasonis

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTQQGQSAVGFNIGYGFDSKNATLGVDYRYCITDAVRLSPSLTYFVKNDNHSTWAIDLNAHYVVKLSEMFGFYPLAGLSLSFWNWDAGHGLSHNETRLGANIGLGGEVYATDNLSIGLEVKYNIIKDFDQAMLGVRVGYSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Surfactant Associated Protein A (SPA) ELISA Kit
DLR-SPA-c-01 48 Tests

Canine Surfactant Associated Protein A (SPA) ELISA Kit

Sign In for Pricing
View Details
Canine Surfactant Associated Protein A (SPA) ELISA Kit
DLR-SPA-c-02 96 Tests

Canine Surfactant Associated Protein A (SPA) ELISA Kit

Sign In for Pricing
View Details
Rat Rho Guanine Nucleotide Exchange Factor 4 (ARHGEF4) ELISA Kit
YLA1328RA-01 48 Tests

Rat Rho Guanine Nucleotide Exchange Factor 4 (ARHGEF4) ELISA Kit

Sign In for Pricing
View Details
Rat Rho Guanine Nucleotide Exchange Factor 4 (ARHGEF4) ELISA Kit
YLA1328RA-02 96 Tests

Rat Rho Guanine Nucleotide Exchange Factor 4 (ARHGEF4) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human OR5AS1 sgRNA gene knockout kit - Lentiviral human OR5AS1 sgRNA gene knockout kit (plasmid)
GTR15366053 1 Vial

Lentiviral human OR5AS1 sgRNA gene knockout kit - Lentiviral human OR5AS1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Chicken SHC-Transforming Protein 1 ELISA Kit
MBS101833 Inquire

Chicken SHC-Transforming Protein 1 ELISA Kit

Sign In for Pricing
View Details