Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-6 (CLDN6), partial-VLPs

This Recombinant Human Claudin-6 (CLDN6), partial spans the amino acid sequence from region 138-181aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

Skullin; CLDN6

UniProt

P56747

Expression Region

138-181aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Microbiology

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

62.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

WTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P22k15 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
35854156 3x 1.0 µg DNA

P22k15 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Human ATP6V1F Protein, GST, E.coli-1mg
QP909-1mg 1mg

Recombinant Human ATP6V1F Protein, GST, E.coli-1mg

Sign In for Pricing
View Details
PE Anti-human CD1 Antibody *HI149*
100101K0-AAT 25 Tests

PE Anti-human CD1 Antibody *HI149*

Sign In for Pricing
View Details
PEMT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV713289 1.0 µg DNA

PEMT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Nfic sgRNA CRISPR Lentivector set (Mouse)
K4728601 3x 1.0 µg

Nfic sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Hsa-miR-4483 agomir
HY-R01091A-01 5 nmol

Hsa-miR-4483 agomir

Sign In for Pricing
View Details